The rna helicase database

Author: mcej

August undefined, 2024

WebbBasic information and list of all helicases was obtained from the Human Genome Organization (HUGO) portal, 37 and 112 helicases mainly include DNA helicase and RNA … WebbThe database provides ready access to sequence, structure, biochemical and cellular function of all RNA helicases from the most widely used model organisms Escherichia …

[PDF] The RNA helicase database - ResearchGate

Webb3 dec. 2024 · 2024-04-03. The following are RNA databases freely accessible online. miRBase database: a searchable database of published miRNA sequences and annotation. miRDB is an online database for miRNA target prediction and functional annotations. Rfam database is an annotated, open access database that contains information about non … Webb3 mars 2024 · In this study, we performed a comprehensive analysis of RNA helicases using multiplatform proteogenomic databases. More than 50% (28/49) of detected RNA helicases were highly expressed in multiple tumor tissues, and more than 60% (17/28) of tumor-associated members were directly involved in DNA damage repair (DDR). new introduced products

Helicase - Wikipedia

WebbRNA helicases are ubiquitous and essential enzymes that function in nearly all aspects of RNA metabolism. The RNA helicase database (www.rnahelicase.org) integrates the … Webb15 juni 1999 · The structure is globular, highly helical and lacks a close structural relative in the database of known protein folds. ... Comparison of this structure to the analogous region of the Rho RNA/DNA helicase indicates that the N-terminal domains of these hexameric helicases are structurally dissimilar. Publication types WebbRNA helicases are ubiquitous and essential enzymes that function in nearly all aspects of RNA metabolism. The RNA helicase database (www.rnahelicase.org) integrates the … newintroshd

Viruses Free Full-Text Novel Putative Tymoviridae-like Virus ...

RNA helicase database - Wikipedia

Webbgroup alignment q9h2u1 dhx36_hs. msydyhqnwgrdggprssgggygggpagghggnrgsggggggggggrggrgrhpghlkgr b2rqs6 dhx36_mm. msydyhqswsrdggprgsg----qgssgggggsrgsggg ... Webb1 feb. 2024 · In plants, RNA helicases play significant roles in growth, development and stress response. In a previous study, a three-fold upregulation of a DEAD-box RNA helicase in a tomato cultivar tolerant to Tomato leaf curl New Delhi virus (ToLCNDV) as compared to susceptible cultivar during virus infection was shown. Given this, a comprehensive … new int size c++Webb12 apr. 2024 · A long noncoding RNA, named CCDSTlnc (cervical cancer DExH-box helicase 9 suppressive transcript), is significantly downregulated in cervical cancer tissues, and binds to upregulated pro-oncogenic DHX9 (DExH-Box Helicase 9) protein, promoter of motility, and angiogenesis (X. Ding et al., 2024). new in tsp

"Webb1 jan. 2024 · The ARCPH helicase database intends primarily to enable researchers to locate and retrieve broad information about sequence, ... The RNA helicase database … " - The rna helicase database

The rna helicase database

WebbProtein family/group databases TCDB 3.A.18.1.1 the nuclear mrna exporter (mrna-e) family Names & Taxonomy Protein names Recommended name Spliceosome RNA helicase DDX39B Curated EC number EC:3.6.4.13 ( UniProtKB ENZYME Rhea) 1 publication Alternative names 56 kDa U2AF65-associated protein ATP-dependent RNA helicase p47 … Webb4 aug. 2024 · Using a curated RiBi gene signature (table S1D) and RNA sequencing (RNA-seq) data from the DepMap consortium, we then categorized all cell lines into low and high RiBi (fig. S1F) and found that eIF4A3 expression is higher in cell lines with high RiBi (Fig. 1D), further supporting a role of the helicase in this process.

Did you know?

WebbActs as an ATP-dependent RNA helicase, able to unwind both RNA-RNA and RNA-DNA duplexes. ... Enzyme and pathway databases. BioCyc. MetaCyc:ENSG00000079785 … Webb25 nov. 2010 · RNA helicases are ubiquitous and essential enzymes that function in nearly all aspects of RNA metabolism. The RNA helicase database (www.rnahelicase.org) …

WebbThe database allows retrieval of comprehensive information on sequence, structure and on biochemical and cellular functions of all RNA helicases from the most widely used …

Webb18 apr. 2014 · RNA Helicase Database The RNA helicase database allows straightforward retrieval of comprehensive information on sequence, structure and on... Also included … Webb8 feb. 2024 · RNA helicases are also frequently associated to ribonucleoprotein complexes (RNP-complexes) important for ribosome assembly and degradation, and for translational control (Van Treeck and Parker,...

WebbFigure 2. Structure of the RNA helicase database. Gray fields represent database pages, lines show the main connections. Link out indicates links to external sequence databases (see text for details). The bold lines around the Homepage, the SF2: DEAD-box page and one individual DEAD-box protein page mark pages shown as screenshots in Figure 3.

Webb3 dec. 2024 · RNAcentral is a free, public resource that offers integrated access to a comprehensive and up-to-date set of non-coding RNA sequences provided by a … inthesedesertsWebb30 nov. 2010 · Component of a multi-helicase-TICAM1 complex that acts as a cytoplasmic sensor of viral double-stranded RNA (dsRNA) and plays a role in the activation of a cascade of antiviral responses including the induction of pro-inflammatory cytokines via the adapter molecule TICAM1 ( By similarity ). new-intunewin32appdetectionrulescriptWebbThis review summarises our current knowledge on eukaryotic RNA helicases involved in ribosome biogenesis, particularly focusing on the most recent advances with respect to the molecular roles of these enzymes and their co-factors in yeast and human cells. new intro youtubeWebbför 2 dagar sedan · Background In plants, RNA silencing is an important conserved mechanism to regulate gene expression and combat against abiotic and biotic stresses. Dicer-like (DCL) and Argonaute (AGO) proteins and RNA-dependent RNA polymerase (RDR) are the core elements involved in gene silencing and their gene families have been … in these decadesWebb13 juni 2024 · The RNA helicases are an important class of enzymes which are known to influence almost every aspect of RNA metabolism. The majority of RNA helicases belong to the SF2 (superfamily 2)... in these delightful pleasant groves purcellWebb"The RNA helicase database". Nucleic Acids Res. England. 39 (Database issue): D338-41. doi: 10.1093/nar/gkq1002. PMC 3013637. PMID 21112871. External links [ edit] www.rnahelicase.org This Biological database -related article is a stub. You can help Wikipedia by expanding it. new intuit accountWebb15 juli 2024 · DExH-box helicase 9 (DHX9) is a nuclear RNA helicase that can interact with inverted complementary sequences and unwind RNA pairs flanking circularized exons to prevent the production of circRNAs . In lung adenocarcinoma (LUAD), overexpressed CircDCUN1D4 significantly inhibits tumor metastasis, reduces glycolysis, and can be … new intro for youtube